Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199030_WB10.jpg WB (Western Blot) (WB Suggested Anti-DLAT Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit DLAT Polyclonal Antibody | anti-DLAT antibody

DLAT antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DLAT; E2; DLTA; PDCE2; PDC-E2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
DLAT, Antibody; DLAT antibody - N-terminal region; anti-DLAT antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
Sequence Length
647
Applicable Applications for anti-DLAT antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DLAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DLAT Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199030_WB10.jpg WB (Western Blot) (WB Suggested Anti-DLAT Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: DLATSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA199030_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: DLATSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: Human Huh7Sample Type: Huh7 lysate (50ug)Primary Antibody Dilution: 1:200Image Submitted By: Partha KasturiUniversity of Kansas Medical Center)

product-image-AAA199030_WB13.jpg WB (Western Blot) (Sample Type: Human Huh7Sample Type: Huh7 lysate (50ug)Primary Antibody Dilution: 1:200Image Submitted By: Partha KasturiUniversity of Kansas Medical Center)

IHC (Immunohistochemistry)

(Rabbit Anti-DLAT AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199030_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-DLAT AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-DLAT antibody
This is a rabbit polyclonal antibody against DLAT. It was validated on Western Blot and immunohistochemistry

Target Description: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT.[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
NCBI Official Synonym Full Names
dihydrolipoamide S-acetyltransferase
NCBI Official Symbol
DLAT
NCBI Official Synonym Symbols
E2; DLTA; PDCE2; PDC-E2
NCBI Protein Information
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
UniProt Protein Name
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
UniProt Gene Name
DLAT
UniProt Synonym Gene Names
DLTA; PBC; PDC-E2; PDCE2
UniProt Entry Name
ODP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DLAT dlat (Catalog #AAA199030) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLAT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DLAT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DLAT dlat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WTPSSGATPR NRLLLQLLGS PGRRYYSLPP HQKVPLPSLS PTMQAGTIAR. It is sometimes possible for the material contained within the vial of "DLAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.