Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199724_WB8.jpg WB (Western Blot) (WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Rabbit DLL1 Polyclonal Antibody | anti-DLL1 antibody

DLL1 antibody - N-terminal region

Gene Names
DLL1; DL1; Delta; DELTA1
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DLL1, Antibody; DLL1 antibody - N-terminal region; anti-DLL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Sequence Length
723
Applicable Applications for anti-DLL1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

product-image-AAA199724_WB8.jpg WB (Western Blot) (WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RatTarget Name: DLL1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA199724_WB10.jpg WB (Western Blot) (Host: RatTarget Name: DLL1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DLL1Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA199724_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: DLL1Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: DLL1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA199724_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: DLL1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DLL1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199724_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: DLL1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-DLL1 antibody
This is a rabbit polyclonal antibody against DLL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
delta-like protein 1
NCBI Official Synonym Full Names
delta like canonical Notch ligand 1
NCBI Official Symbol
DLL1
NCBI Official Synonym Symbols
DL1; Delta; DELTA1
NCBI Protein Information
delta-like protein 1
UniProt Protein Name
Delta-like protein 1
UniProt Gene Name
DLL1
UniProt Synonym Gene Names
Delta1; H-Delta-1
UniProt Entry Name
DLL1_HUMAN

Similar Products

Product Notes

The DLL1 dll1 (Catalog #AAA199724) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLL1 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DLL1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DLL1 dll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSRCALALAV LSALLCQVWS SGVFELKLQE FVNKKGLLGN RNCCRGGAGP. It is sometimes possible for the material contained within the vial of "DLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.