Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199977_WB13.jpg WB (Western Blot) (WB Suggested Anti-DNMT3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysateDNMT3B is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit DNMT3B Polyclonal Antibody | anti-DNMT3B antibody

DNMT3B antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DNMT3B; ICF; ICF1; M.HsaIIIB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNMT3B, Antibody; DNMT3B antibody - middle region; anti-DNMT3B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC
Sequence Length
770
Applicable Applications for anti-DNMT3B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DNMT3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DNMT3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysateDNMT3B is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA199977_WB13.jpg WB (Western Blot) (WB Suggested Anti-DNMT3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysateDNMT3B is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Sample Type :Lane 1: 20ug mouse mesenchymal stem cell lysate Primary Antibody Dilution :1:2000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Color/Signal Descriptions:DNMT3B Gene Name:Anonymous Submitted by:)

product-image-AAA199977_WB15.jpg WB (Western Blot) (Sample Type :Lane 1: 20ug mouse mesenchymal stem cell lysate Primary Antibody Dilution :1:2000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Color/Signal Descriptions:DNMT3B Gene Name:Anonymous Submitted by:)
Related Product Information for anti-DNMT3B antibody
This is a rabbit polyclonal antibody against DNMT3B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 3B isoform 3
NCBI Official Synonym Full Names
DNA methyltransferase 3 beta
NCBI Official Symbol
DNMT3B
NCBI Official Synonym Symbols
ICF; ICF1; M.HsaIIIB
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 3B
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3B
UniProt Gene Name
DNMT3B
UniProt Synonym Gene Names
Dnmt3b; DNA MTase HsaIIIB; M.HsaIIIB
UniProt Entry Name
DNM3B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DNMT3B dnmt3b (Catalog #AAA199977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNMT3B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT3B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DNMT3B dnmt3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTGRLFFEFY HLLNYSRPKE GDDRPFFWMF ENVVAMKVGD KRDISRFLEC. It is sometimes possible for the material contained within the vial of "DNMT3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.