Rabbit DPH4 Polyclonal Antibody | anti-DNAJC24 antibody
DPH4 antibody - N-terminal region
Gene Names
DNAJC24; DPH4; JJJ3; ZCSL3
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPH4, Antibody; DPH4 antibody - N-terminal region; anti-DNAJC24 antibody
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-DNAJC24 antibody
WB (Western Blot)
Protein Size (# AA)
149 amino acids
Official Gene Full Name
DnaJ (Hsp40) homolog, subfamily C, member 24
Alias Symbols
JJJ3, ZCSL3, DPH4
Peptide Sequence
Synthetic peptide located within the following region: MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG
Blocking Peptide
For anti-DNAJC24 (MBS3211292) antibody is Catalog # MBS3236244
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DPH4
Protein Name
DnaJ homolog subfamily C member 24
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DNAJC24 antibody
Description of Target: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 CD685768.1 19-28 11-652 AL833128.1 1-642 653-3000 AC108456.7 42515-44862
Product Categories/Family for anti-DNAJC24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 24
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C24
NCBI Official Symbol
DNAJC24
NCBI Official Synonym Symbols
DPH4; JJJ3; ZCSL3
NCBI Protein Information
dnaJ homolog subfamily C member 24
UniProt Protein Name
DnaJ homolog subfamily C member 24
UniProt Gene Name
DNAJC24
UniProt Synonym Gene Names
DPH4; ZCSL3
UniProt Entry Name
DJC24_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DNAJC24 dnajc24 (Catalog #AAA200294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPH4 antibody - N-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPH4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DNAJC24 dnajc24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPH4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
