Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199497_WB11.jpg WB (Western Blot) (WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit DPP6 Polyclonal Antibody | anti-DPP6 antibody

DPP6 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DPP6; VF2; DPL1; DPPX; MRD33
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPP6, Antibody; DPP6 antibody - middle region; anti-DPP6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT
Sequence Length
801
Applicable Applications for anti-DPP6 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

product-image-AAA199497_WB11.jpg WB (Western Blot) (WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

WB (Western Blot)

(Researcher: Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical SchoolApplication: Western blottingSpecies+tissue/cell type: Mouse WT and DPP6 -/- brainHow many ug'sof tissue/cell lysate run on the gel:1. 20ug Mouse WT brain extract2. 20ug Mouse DPP6 -/- brain extract3: 20ug Mouse WT brain extract4: 20ug Mouse DPP6 -/- brain extractPrimary antibody dilution: 1:1000Secondary antibody: Donkey anti-rabbbit HRPSecondary antibody dilution: 1: 10,000)

product-image-AAA199497_WB13.jpg WB (Western Blot) (Researcher: Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical SchoolApplication: Western blottingSpecies+tissue/cell type: Mouse WT and DPP6 -/- brainHow many ug'sof tissue/cell lysate run on the gel:1. 20ug Mouse WT brain extract2. 20ug Mouse DPP6 -/- brain extract3: 20ug Mouse WT brain extract4: 20ug Mouse DPP6 -/- brain extractPrimary antibody dilution: 1:1000Secondary antibody: Donkey anti-rabbbit HRPSecondary antibody dilution: 1: 10,000)

WB (Western Blot)

(Lanes:Lane 1: 20ug HEK-293 cell lysateLane 2: 20ug hDPP6-YFP transfected HEK-293 lysateLane 3: 20ug hDPP10-YFP transfected HEK-293 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:DPP6 aSubmitted by:Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology)

product-image-AAA199497_WB15.jpg WB (Western Blot) (Lanes:Lane 1: 20ug HEK-293 cell lysateLane 2: 20ug hDPP6-YFP transfected HEK-293 lysateLane 3: 20ug hDPP10-YFP transfected HEK-293 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:DPP6 aSubmitted by:Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology)
Related Product Information for anti-DPP6 antibody
This is a rabbit polyclonal antibody against DPP6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-DPP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
dipeptidyl aminopeptidase-like protein 6 isoform 3
NCBI Official Synonym Full Names
dipeptidyl peptidase like 6
NCBI Official Symbol
DPP6
NCBI Official Synonym Symbols
VF2; DPL1; DPPX; MRD33
NCBI Protein Information
dipeptidyl aminopeptidase-like protein 6
UniProt Protein Name
Dipeptidyl aminopeptidase-like protein 6
UniProt Gene Name
DPP6
UniProt Synonym Gene Names
DPP VI
UniProt Entry Name
DPP6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DPP6 dpp6 (Catalog #AAA199497) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPP6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DPP6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DPP6 dpp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAINDSRVPI MELPTYTGSI YPTVKPYHYP KAGSENPSIS LHVIGLNGPT. It is sometimes possible for the material contained within the vial of "DPP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.