Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281005_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse heart using DSP antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse DSP Polyclonal Antibody | anti-DSP antibody

DSP Polyclonal Antibody

Gene Names
DSP; DP; DCWHKTA
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
DSP, Antibody; DSP Polyclonal Antibody; DCWHKTA; DP; anti-DSP antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Desmoplakin1 and Desmoplakin2
Purity/Purification
Affinity Purification
Sequence
AIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSF
Sequence Length
2272
Applicable Applications for anti-DSP antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Synthetic peptide of human DSP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cytoplasm, cytoskeleton, desmosome
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse heart using DSP antibody at dilution of 1:100 (40x lens).)

product-image-AAA281005_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse heart using DSP antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using DSP antibody at dilution of 1:100 (40x lens).)

product-image-AAA281005_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using DSP antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of A431 cells, using DSP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281005_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of A431 cells, using DSP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-DSP antibody
This gene encodes a protein that anchors intermediate filaments to desmosomal plaques and forms an obligate component of functional desmosomes. Mutations in this gene are the cause of several cardiomyopathies and keratodermas, including skin fragility-woolly hair syndrome. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DSP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 260kDa; 278kDa; 331kDa
Observed: 300kDa
NCBI Official Full Name
desmoplakin isoform II
NCBI Official Synonym Full Names
desmoplakin
NCBI Official Symbol
DSP
NCBI Official Synonym Symbols
DP; DCWHKTA
NCBI Protein Information
desmoplakin
UniProt Protein Name
Desmoplakin
UniProt Gene Name
DSP
UniProt Synonym Gene Names
DP

Similar Products

Product Notes

The DSP dsp (Catalog #AAA281005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DSP Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DSP can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DSP dsp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AIRKGFIDGR AAQRLQDTSS YAKILTCPKT KLKISYKDAI NRSMVEDITG LRLLEAASVS SKGLPSPYNM SSAPGSRSGS RSGSRSGSRS GSRSGSRRGS F. It is sometimes possible for the material contained within the vial of "DSP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.