Rabbit E2F1 Polyclonal Antibody | anti-E2F1 antibody
E2F1 Antibody
Gene Names
E2F1; RBP3; E2F-1; RBAP1; RBBP3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunoprecipitation, ELISA
Synonyms
E2F1, Antibody; E2F1 Antibody; DmelCG6376; drosE2F1; E(Sev-CycE)3A; E(var)3-93E; Evar(3)164; l(3)07172; l(3)j3B1; l(3)j3C2; l(3)rM729; PBR 3; PRB binding protein E2F 1; RBAP 1; RBP 3; Retinoblastoma associated protein 1; Retinoblastoma binding protein 3; Transcription factor E2F1 antibody; anti-E2F1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Form/Format
Affinity Purified
Concentration
0.65 ug/ul in antibody stabilization buffer (varies by lot)
Sequence Length
437
Applicable Applications for anti-E2F1 antibody
WB (Western Blot), IP (Immunoprecipitation), ELISA
Immunogen
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.
Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Determinant
N-epitope
Molecular Function
DNA-binding; Apoptosis
Structure
Component of DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members.
Subcellular Location
Nucleus
Preparation and Storage
-20 degree C for long term storage
Related Product Information for anti-E2F1 antibody
Affinity Purified E2F transcription factor 1 Antibody N-epitope
Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site.
Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site.
Product Categories/Family for anti-E2F1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,920 Da
NCBI Official Full Name
Transcription factor E2F1
NCBI Official Synonym Full Names
E2F transcription factor 1
NCBI Official Symbol
E2F1
NCBI Official Synonym Symbols
RBP3; E2F-1; RBAP1; RBBP3
NCBI Protein Information
transcription factor E2F1
UniProt Protein Name
Transcription factor E2F1
UniProt Gene Name
E2F1
UniProt Synonym Gene Names
RBBP3; E2F-1; RBAP-1; RBBP-3
UniProt Entry Name
E2F1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The E2F1 e2f1 (Catalog #AAA75691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's E2F1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), ELISA. Researchers should empirically determine the suitability of the E2F1 e2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "E2F1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
