Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46831_IHC10.jpg IHC (Immunohistochemistry) (E2F4 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit E2F4 Polyclonal Antibody | anti-E2F4 antibody

Anti-E2F4 Antibody

Average rating 0.0
No ratings yet
Gene Names
E2F4; E2F-4
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
E2F4, Antibody; Anti-E2F4 Antibody; E2F4; E2F-4; Transcription factor E2F4; Q16254; E2F transcription factor 4, p107/p130-binding; anti-E2F4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
413
Applicable Applications for anti-E2F4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(E2F4 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46831_IHC10.jpg IHC (Immunohistochemistry) (E2F4 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(E2F4 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46831_IHC11.jpg IHC (Immunohistochemisry) (E2F4 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(E2F4 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46831_IHC13.jpg IHC (Immunohiostchemistry) (E2F4 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of E2F4 expression in HELA whole cell lysates (lane 1), U20S whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). E2F4 at 44KD, 60KD was detected using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46831_WB15.jpg WB (Western Blot) (Western blot analysis of E2F4 expression in HELA whole cell lysates (lane 1), U20S whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). E2F4 at 44KD, 60KD was detected using rabbit anti- E2F4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-E2F4 antibody
Rabbit IgG polyclonal antibody for Transcription factor E2F4(E2F4) detection.
Background: Transcription factor E2F4 is a protein that in humans is encoded by the E2F4 gene. The protein encoded by this gene is a member of the E2F family of transcription factors. This gene is mapped to 16q22.1. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. Additionally, it plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
References
1. Ginsberg, D., Vairo, G., Chittenden, T., Xiao, Z.-X., Xu, G., Wydner, K. L., DeCaprio, J. A., Lawrence, J. B., Livingston, D. M. E2F-4, a new member of the E2F transcription factor family, interacts with p107. Genes Dev. 8: 2665-2679, 1994.
2. Leone, G., Sears, R., Huang, E., Rempel, R., Nuckolls, F., Park, C.-H., Giangrande, P., Wu, L., Saavedra, H. I., Field, S. J., Thompson, M. A., Yang, H., Fujiwara, Y., Greenberg, M. E., Orkin, S., Smith, C., Nevins, J. R. Myc requires distinct E2F activities to induce S phase and apoptosis. Molec. Cell 8: 105-113, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,960 Da
NCBI Official Full Name
transcription factor E2F4
NCBI Official Synonym Full Names
E2F transcription factor 4
NCBI Official Symbol
E2F4
NCBI Official Synonym Symbols
E2F-4
NCBI Protein Information
transcription factor E2F4
UniProt Protein Name
Transcription factor E2F4
UniProt Gene Name
E2F4
UniProt Synonym Gene Names
E2F-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The E2F4 e2f4 (Catalog #AAA46831) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-E2F4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's E2F4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the E2F4 e2f4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "E2F4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.