Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198194_WB8.jpg WB (Western Blot) (WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)

Rabbit E2f7 Polyclonal Antibody | anti-E2F7 antibody

E2f7 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
E2f7; E2F-7; D10Ertd739e; A630014C11Rik
Reactivity
Human, Mouse
Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
E2f7, Antibody; E2f7 antibody - N-terminal region; anti-E2F7 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE
Sequence Length
904
Applicable Applications for anti-E2F7 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 86%; Horse: 85%; Human: 86%; Mouse: 100%; Pig: 92%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2f7
Protein Size
904 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)

product-image-AAA198194_WB8.jpg WB (Western Blot) (WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mlPositive Control: SP2/0 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: E2F7Sample Type: SP2/0 Whole Cell lysatesAntibody Dilution: 0.05ug/ml)

product-image-AAA198194_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: E2F7Sample Type: SP2/0 Whole Cell lysatesAntibody Dilution: 0.05ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: E2F7Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA198194_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: E2F7Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: E2f7Sample Tissue: Human NIH-3T3Antibody Dilution: 1.0ug/ml)

product-image-AAA198194_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: E2f7Sample Tissue: Human NIH-3T3Antibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Mouse stomach)

product-image-AAA198194_IHC15.jpg IHC (Immunohistochemistry) (Mouse stomach)
Related Product Information for anti-E2F7 antibody
This is a rabbit polyclonal antibody against E2f7. It was validated on Western Blot and immunohistochemistry

Target Description: E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
transcription factor E2F7
NCBI Official Synonym Full Names
E2F transcription factor 7
NCBI Official Symbol
E2f7
NCBI Official Synonym Symbols
E2F-7; D10Ertd739e; A630014C11Rik
NCBI Protein Information
transcription factor E2F7

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The E2F7 (Catalog #AAA198194) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2f7 antibody - N-terminal region reacts with Human, Mouse Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's E2f7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the E2F7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEVNCLTLKD LISPRQTRLD FAIEDAENAQ KENIFVDRSR MTPKTPMKNE. It is sometimes possible for the material contained within the vial of "E2f7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.