Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199156_WB13.jpg WB (Western Blot) (WB Suggested Anti-EDG8 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Rabbit EDG8 Polyclonal Antibody | anti-S1PR5 antibody

EDG8 antibody - N-terminal region

Gene Names
S1PR5; EDG8; S1P5; Edg-8; SPPR-1; SPPR-2
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
EDG8, Antibody; EDG8 antibody - N-terminal region; anti-S1PR5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
Sequence Length
147
Applicable Applications for anti-S1PR5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 80%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EDG8 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199156_WB13.jpg WB (Western Blot) (WB Suggested Anti-EDG8 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA199156_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-S1PR5 antibody
This is a rabbit polyclonal antibody against EDG8. It was validated on Western Blot and immunohistochemistry

Target Description: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
Product Categories/Family for anti-S1PR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
endothelial differentiation, sphingolipid G-protein-coupled receptor, 8, isoform CRA_c
NCBI Official Synonym Full Names
sphingosine-1-phosphate receptor 5
NCBI Official Symbol
S1PR5
NCBI Official Synonym Symbols
EDG8; S1P5; Edg-8; SPPR-1; SPPR-2
NCBI Protein Information
sphingosine 1-phosphate receptor 5
UniProt Protein Name
Sphingosine 1-phosphate receptor 5
UniProt Gene Name
S1PR5
UniProt Synonym Gene Names
EDG8; S1P receptor 5; S1P5; S1P receptor Edg-8
UniProt Entry Name
S1PR5_HUMAN

Similar Products

Product Notes

The S1PR5 s1pr5 (Catalog #AAA199156) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDG8 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EDG8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the S1PR5 s1pr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MESGLLRPAP VSEVIVLHYN YTGKLRGARY QPGAGLRADA VVCLAVCAFI. It is sometimes possible for the material contained within the vial of "EDG8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.