Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23445_WB8.jpg WB (Western Blot) (WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: OVCAR-3 cell lysateEED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Rabbit EED Polyclonal Antibody | anti-EED antibody

EED antibody - N-terminal region

Gene Names
EED; HEED; COGIS; WAIT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
EED, Antibody; EED antibody - N-terminal region; anti-EED antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
Sequence Length
441
Applicable Applications for anti-EED antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: OVCAR-3 cell lysateEED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

product-image-AAA23445_WB8.jpg WB (Western Blot) (WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: OVCAR-3 cell lysateEED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

product-image-AAA23445_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23445_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23445_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23445_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23445_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EEDSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23445_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: EEDSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

IF (Immunofluorescence)

(Sample Type : Rat Brain lysateDilution:1:500)

product-image-AAA23445_IF.jpg IF (Immunofluorescence) (Sample Type : Rat Brain lysateDilution:1:500)
Related Product Information for anti-EED antibody
This is a rabbit polyclonal antibody against EED. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
polycomb protein EED isoform a
NCBI Official Synonym Full Names
embryonic ectoderm development
NCBI Official Symbol
EED
NCBI Official Synonym Symbols
HEED; COGIS; WAIT1
NCBI Protein Information
polycomb protein EED
UniProt Protein Name
Polycomb protein EED
UniProt Gene Name
EED
UniProt Synonym Gene Names
hEED; WAIT-1
UniProt Entry Name
EED_HUMAN

Similar Products

Product Notes

The EED eed (Catalog #AAA23445) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EED antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EED can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the EED eed for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDENDDAVSI ESGTNTERPD TPTNTPNAPG RKSWGKGKWK SKKCKYSFKC. It is sometimes possible for the material contained within the vial of "EED, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.