WB (Western Blot)
(WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateEFEMP1 is supported by BioGPS gene expression data to be expressed in HT1080)
Rabbit EFEMP1 Polyclonal Antibody | anti-EFEMP1 antibody
EFEMP1 antibody - middle region
Gene Names
EFEMP1; DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EFEMP1, Antibody; EFEMP1 antibody - middle region; anti-EFEMP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
Sequence Length
493
Applicable Applications for anti-EFEMP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateEFEMP1 is supported by BioGPS gene expression data to be expressed in HT1080)
WB (Western Blot)
(WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateEFEMP1 is supported by BioGPS gene expression data to be expressed in HT1080)
IHC (Immunohistochemistry)
(Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-EFEMP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-EFEMP1 antibody
This is a rabbit polyclonal antibody against EFEMP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne h
Target Description: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne h
Product Categories/Family for anti-EFEMP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Synonym Full Names
EGF containing fibulin extracellular matrix protein 1
NCBI Official Symbol
EFEMP1
NCBI Official Synonym Symbols
DHRD; DRAD; FBNL; MLVT; MTLV; S1-5; FBLN3; FIBL-3
NCBI Protein Information
EGF-containing fibulin-like extracellular matrix protein 1
UniProt Protein Name
EGF-containing fibulin-like extracellular matrix protein 1
UniProt Gene Name
EFEMP1
UniProt Synonym Gene Names
FBLN3; FBNL; FIBL-3
UniProt Entry Name
FBLN3_HUMAN
Similar Products
Product Notes
The EFEMP1 efemp1 (Catalog #AAA198871) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFEMP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EFEMP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EFEMP1 efemp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNENGEFYLR QTSPVSAMLV LVKSLSGPRE HIVDLEMLTV SSIGTFRTSS. It is sometimes possible for the material contained within the vial of "EFEMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.