Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201048_WB11.jpg WB (Western Blot) (WB Suggested Anti-EGFR AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit EGFR Polyclonal Antibody | anti-EGFR antibody

EGFR antibody - middle region

Gene Names
EGFR; ERBB; HER1; mENA; ERBB1; PIG61; NISBD2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EGFR, Antibody; EGFR antibody - middle region; anti-EGFR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
Sequence Length
628
Applicable Applications for anti-EGFR antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%; Zebrafish: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EGFR AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

product-image-AAA201048_WB11.jpg WB (Western Blot) (WB Suggested Anti-EGFR AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

WB (Western Blot)

(Lanes:Lane 1: 4ug DRM fraction from MDA-MB-231Primary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit IgG-HRPSecondary Antibody Dilution:1:10000Gene Name:EGFRSubmitted by:Katarzyna Augoff, University of WroclawEGFR is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB231 cells)

product-image-AAA201048_WB13.jpg WB (Western Blot) (Lanes:Lane 1: 4ug DRM fraction from MDA-MB-231Primary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit IgG-HRPSecondary Antibody Dilution:1:10000Gene Name:EGFRSubmitted by:Katarzyna Augoff, University of WroclawEGFR is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB231 cells)

IHC (Immunohistochemistry)

(Rabbit Anti-EGFR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201048_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-EGFR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-EGFR antibody
This is a rabbit polyclonal antibody against EGFR. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
epidermal growth factor receptor isoform b
NCBI Official Synonym Full Names
epidermal growth factor receptor
NCBI Official Symbol
EGFR
NCBI Official Synonym Symbols
ERBB; HER1; mENA; ERBB1; PIG61; NISBD2
NCBI Protein Information
epidermal growth factor receptor
UniProt Protein Name
Epidermal growth factor receptor
UniProt Gene Name
EGFR
UniProt Synonym Gene Names
ERBB; ERBB1; HER1
UniProt Entry Name
EGFR_HUMAN

Similar Products

Product Notes

The EGFR egfr (Catalog #AAA201048) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGFR antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EGFR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EGFR egfr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTDHGSCVRA CGADSYEMEE DGVRKCKKCE GPCRKVCNGI GIGEFKDSLS. It is sometimes possible for the material contained within the vial of "EGFR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.