Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198641_WB11.jpg WB (Western Blot) (WB Suggested Anti-EIF4E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit EIF4E Polyclonal Antibody | anti-EIF4E antibody

EIF4E antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
EIF4E; CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
EIF4E, Antibody; EIF4E antibody - C-terminal region; anti-EIF4E antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Sequence Length
217
Applicable Applications for anti-EIF4E antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human EIF4E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EIF4E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

product-image-AAA198641_WB11.jpg WB (Western Blot) (WB Suggested Anti-EIF4E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: EIF4ESample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198641_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: EIF4ESample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Lung, respiratory epithelium tissue at an antibody concentration of 5ug/ml using anti-EIF4E antibody)

product-image-AAA198641_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Lung, respiratory epithelium tissue at an antibody concentration of 5ug/ml using anti-EIF4E antibody)
Related Product Information for anti-EIF4E antibody
This is a rabbit polyclonal antibody against EIF4E. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G (MIM 600495) (Rychlik et al., 1987 [PubMed 3469651]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E
NCBI Official Symbol
EIF4E
NCBI Official Synonym Symbols
CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
NCBI Protein Information
eukaryotic translation initiation factor 4E
UniProt Protein Name
Eukaryotic translation initiation factor 4E
UniProt Gene Name
EIF4E
UniProt Synonym Gene Names
EIF4EL1; EIF4F; eIF-4E; eIF4E
UniProt Entry Name
IF4E_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EIF4E eif4e (Catalog #AAA198641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF4E antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4E can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EIF4E eif4e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TECENREAVT HIGRVYKERL GLPPKIVIGY QSHADTATKS GSTTKNRFVV. It is sometimes possible for the material contained within the vial of "EIF4E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.