Rabbit ELF1 Polyclonal Antibody | anti-ELF1 antibody
ELF1 Antibody - C-terminal region
Gene Names
ELF1; RIA1; EFTUD1
Reactivity
Tested: RatPredicted: Dog, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELF1, Antibody; ELF1 Antibody - C-terminal region; anti-ELF1 antibody
Host
Rabbit
Reactivity
Tested: Rat
Predicted: Dog, Horse, Human, Mouse
Predicted: Dog, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAM
Sequence Length
361
Applicable Applications for anti-ELF1 antibody
WB (Western Blot)
Homology
Dog: 80%; Horse: 80%; Human: 80%; Mouse: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of RAT DKFZp686H0575
Protein Size (#AA)
361 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ELF1 antibody
This is a rabbit polyclonal antibody against DKFZp686H0575. It was validated on Western Blot
Target Description: This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ELF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
39kDa
NCBI Official Full Name
Hypothetical protein DKFZp686H0575
NCBI Official Synonym Full Names
E74 like ETS transcription factor 1
NCBI Official Symbol
ELF1
NCBI Official Synonym Symbols
RIA1; EFTUD1
NCBI Protein Information
ETS-related transcription factor Elf-1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ELF1 (Catalog #AAA198136) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELF1 Antibody - C-terminal region reacts with Tested: Rat Predicted: Dog, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ELF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ELF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQETKTLTQE VEKKESEDHL KENTEKTEQQ PQPYVMVVSS SNGFTSQVAM. It is sometimes possible for the material contained within the vial of "ELF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
