Rabbit ELF1 Polyclonal Antibody | anti-ELF1 antibody
ELF1 antibody - N-terminal region
Gene Names
Elf1; p70; Sts1; Elf-1; mElf-1
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELF1, Antibody; ELF1 antibody - N-terminal region; anti-ELF1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT
Sequence Length
612
Applicable Applications for anti-ELF1 antibody
WB (Western Blot)
Homology
Dog: 80%; Horse: 80%; Human: 87%; Mouse: 100%; Rabbit: 87%; Rat: 88%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ELF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ELF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-ELF1 antibody
This is a rabbit polyclonal antibody against ELF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Elf1 belongs to the ETS family. Elf1 is a transcription factor that activates the LYN and BLK promoters. Elf1 may interact with other transcription factors in order to regulate specific genes. Elf1 can bind to the underphosphorylated form of RB.
Target Description: Elf1 belongs to the ETS family. Elf1 is a transcription factor that activates the LYN and BLK promoters. Elf1 may interact with other transcription factors in order to regulate specific genes. Elf1 can bind to the underphosphorylated form of RB.
Product Categories/Family for anti-ELF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
ETS-related transcription factor Elf-1 isoform 1
NCBI Official Synonym Full Names
E74-like factor 1
NCBI Official Symbol
Elf1
NCBI Official Synonym Symbols
p70; Sts1; Elf-1; mElf-1
NCBI Protein Information
ETS-related transcription factor Elf-1
UniProt Protein Name
ETS-related transcription factor Elf-1
UniProt Gene Name
Elf1
UniProt Entry Name
ELF1_MOUSE
Similar Products
Product Notes
The ELF1 elf1 (Catalog #AAA198137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELF1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ELF1 elf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDIVAPITHV SVTLDGIPEV METQQVQETN ADSPGASSPE QRKRKKGRKT. It is sometimes possible for the material contained within the vial of "ELF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
