Rabbit anti-Cow, Human EMP2 Polyclonal Antibody | anti-EMP2 antibody
EMP2 antibody - middle region
Gene Names
EMP2; XMP
Reactivity
Cow, Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
EMP2, Antibody; EMP2 antibody - middle region; anti-EMP2 antibody
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
Sequence Length
167
Applicable Applications for anti-EMP2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 82%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EMP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-EMP2 antibody
This is a rabbit polyclonal antibody against EMP2. It was validated on Western Blot and immunohistochemistry
Target Description: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognized as a putative tumor suppressor gene in certain model systems.
Target Description: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognized as a putative tumor suppressor gene in certain model systems.
Product Categories/Family for anti-EMP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
epithelial membrane protein 2
NCBI Official Synonym Full Names
epithelial membrane protein 2
NCBI Official Symbol
EMP2
NCBI Official Synonym Symbols
XMP
NCBI Protein Information
epithelial membrane protein 2
UniProt Protein Name
Epithelial membrane protein 2
UniProt Gene Name
EMP2
UniProt Synonym Gene Names
XMP; EMP-2
UniProt Entry Name
EMP2_HUMAN
Similar Products
Product Notes
The EMP2 emp2 (Catalog #AAA198916) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EMP2 antibody - middle region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EMP2 emp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQLMSCLCVM IAASIYTDRR EDIHDKNAKF YPVTREGSYG YSYILAWVAF. It is sometimes possible for the material contained within the vial of "EMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
