Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283189_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using EP300 Rabbit pAb (AAA283189) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit anti-Human EP300 Polyclonal Antibody | anti-EP300 antibody

EP300 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Affinity purification
Synonyms
EP300, Antibody; EP300 Rabbit pAb; p300; KAT3B; MKHK2; RSTS2; EP300; anti-EP300 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
LSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQP
Applicable Applications for anti-EP300 antibody
ELISA, IHC (Immunohistochemistry)
Cross Reactivity
Mouse, Rat
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 940-1030 of human EP300(NP_001420.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using EP300 Rabbit pAb (AAA283189) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283189_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using EP300 Rabbit pAb (AAA283189) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using EP300 Rabbit pAb (AAA283189) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283189_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using EP300 Rabbit pAb (AAA283189) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Related Product Information for anti-EP300 antibody
This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 264kDa
UniProt Protein Name
Histone acetyltransferase p300
UniProt Gene Name
EP300
UniProt Synonym Gene Names
P300; p300 HAT
UniProt Entry Name
EP300_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EP300 ep300 (Catalog #AAA283189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EP300 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EP300 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EP300 ep300 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSQPAVSIEG QVSNPPSTSS TEVNSQAIAE KQPSQEVKME AKMEVDQPEP ADTQPEDISE SKVEDCKMES TETEERSTEL KTEIKEEEDQ P. It is sometimes possible for the material contained within the vial of "EP300, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.