Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46833_IHC11.jpg IHC (Immunohistochemisry) (EPCAM was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit anti-Human EPCAM Polyclonal Antibody | anti-EPCAM antibody

Anti-EPCAM Antibody

Gene Names
EPCAM; ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
EPCAM, Antibody; Anti-EPCAM Antibody; AUA1; CD326; CD326 antigen; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; EpCAM ; Ep-CAM; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; KS1/4; M1S 1; M1S2; M4S1; MIC18; MK 1; TACD1; TACSTD1; TROP1; P16422; Epithelial cell adhesion molecule; anti-EPCAM antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
314
Applicable Applications for anti-EPCAM antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids.
Relevant Detection Systems
The lab provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit in WB, supported by in IHC(P), IHC(F) and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(EPCAM was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46833_IHC11.jpg IHC (Immunohistochemisry) (EPCAM was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(EPCAM was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46833_IHC13.jpg IHC (Immunohiostchemistry) (EPCAM was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of EPCAM expression in HELA whole cell lysates (lane 1), A549 whole cell lysates (lane 2) and PANC-1 whole cell lysates (lane 3). EPCAM at 40KD was detected using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46833_WB15.jpg WB (Western Blot) (Western blot analysis of EPCAM expression in HELA whole cell lysates (lane 1), A549 whole cell lysates (lane 2) and PANC-1 whole cell lysates (lane 3). EPCAM at 40KD was detected using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-EPCAM antibody
Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection.
Background: Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
References
1. Litvinov, Sergey; et al. (1994). "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule". The Journal of Cell Biology 125 (2): 437-46.
2. Maetzel, Dorothea; et al. (2009). "Nuclear signalling by tumour-associated antigen EpCAM". Nature Cell Biology 11 (2): 162-71.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
epithelial cell adhesion molecule
NCBI Official Synonym Full Names
epithelial cell adhesion molecule
NCBI Official Symbol
EPCAM
NCBI Official Synonym Symbols
ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
NCBI Protein Information
epithelial cell adhesion molecule
UniProt Protein Name
Epithelial cell adhesion molecule
UniProt Gene Name
EPCAM
UniProt Synonym Gene Names
GA733-2; M1S2; M4S1; MIC18; TACSTD1; TROP1; Ep-CAM; EGP; EGP314; hEGP314

Similar Products

Product Notes

The EPCAM epcam (Catalog #AAA46833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-EPCAM Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPCAM can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EPCAM epcam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPCAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.