Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46576_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Eph receptor B1 Picoband antibody, AAA46576, IHC(P)IHC(P): Human Glioma Tissue)

anti-Human Eph receptor B1 Polyclonal Antibody | anti-EPHB1 antibody

Anti-Eph receptor B1 Antibody

Gene Names
EPHB1; ELK; NET; Hek6; EPHT2
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Eph receptor B1, Antibody; Anti-Eph receptor B1 Antibody; Ephrin type-B receptor 1; Cek 6; EK6; ELK; Elkh; EPH receptor B1; Eph tyrosine kinase 2; EPH-like kinase 6; Ephb1; EPHB1_HUMAN; Ephrin type B receptor 1; EPHT2; HEK 6; HEK6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; Tyrosine protein kinase receptor EPH 2; Tyrosine-protein kinase receptor EPH-2; anti-EPHB1 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
984
Applicable Applications for anti-EPHB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- Eph receptor B1 Picoband antibody, AAA46576, IHC(P)IHC(P): Human Glioma Tissue)

product-image-AAA46576_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Eph receptor B1 Picoband antibody, AAA46576, IHC(P)IHC(P): Human Glioma Tissue)

WB (Western Blot)

(Anti- Eph receptor B1 Picoband antibody, AAA46576, Western blottingAll lanes: Anti Eph receptor B1 (AAA46576) at 0.5ug/mlWB: 293T Whole Cell Lysate at 40ugPredicted bind size: 111KDObserved bind size: 111KD)

product-image-AAA46576_WB15.jpg WB (Western Blot) (Anti- Eph receptor B1 Picoband antibody, AAA46576, Western blottingAll lanes: Anti Eph receptor B1 (AAA46576) at 0.5ug/mlWB: 293T Whole Cell Lysate at 40ugPredicted bind size: 111KDObserved bind size: 111KD)
Related Product Information for anti-EPHB1 antibody
Description: Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.

Background: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
References
1. "Entrez Gene: EPHB1 EPH receptor B1". 2. Flanagan JG, Vanderhaeghen P (1998). "The ephrins and Eph receptors in neural development". Annu. Rev. Neurosci. 21: 309-45. 3. Tang XX, Biegel JA, Nycum LM, Yoshioka A, Brodeur GM, Pleasure DE, Ikegaki N (Aug 1996). "cDNA cloning, molecular characterization, and chromosomal localization of NET(EPHT2), a human EPH-related receptor protein-tyrosine kinase gene preferentially expressed in brain".Genomics 29 (2): 426-37.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,906 Da
NCBI Official Full Name
ephrin type-B receptor 1
NCBI Official Synonym Full Names
EPH receptor B1
NCBI Official Symbol
EPHB1
NCBI Official Synonym Symbols
ELK; NET; Hek6; EPHT2
NCBI Protein Information
ephrin type-B receptor 1
UniProt Protein Name
Ephrin type-B receptor 1
UniProt Gene Name
EPHB1
UniProt Synonym Gene Names
ELK; EPHT2; HEK6; NET; EK6; hEK6; NET
UniProt Entry Name
EPHB1_HUMAN

Similar Products

Product Notes

The EPHB1 ephb1 (Catalog #AAA46576) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Eph receptor B1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Eph receptor B1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EPHB1 ephb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Eph receptor B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.