Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46491_IHC10.jpg IHC (Immunohistochemistry) (Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Human Mammary Cancer Tissue)

EWSR1 Polyclonal Antibody | anti-EWSR1 antibody

Anti-EWSR1 Antibody

Gene Names
EWSR1; EWS; EWS-FLI1; bK984G1.4
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
EWSR1, Antibody; Anti-EWSR1 Antibody; RNA-binding protein EWS; bK984G1.4; bK984G1.4 Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma breakpoint region 1; Ewing sarcoma breakpoint region 1 protein; Ewings sarcoma EWS Fli1 type 1 oncogene; EWS; EWS oncogene; EWS RNA binding protein 1; EWS_HUMAN; EWSR 1; Ewsr1; EWSR1 protein; RNA binding protein EWS; EWS RNA-binding protein 1; anti-EWSR1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
655
Applicable Applications for anti-EWSR1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46491_IHC10.jpg IHC (Immunohistochemistry) (Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Rat Testis Tissue)

product-image-AAA46491_IHC11.jpg IHC (Immunohistochemisry) (Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Rat Testis Tissue)

IHC (Immunohiostchemistry)

(Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Mouse Testis Tissue)

product-image-AAA46491_IHC13.jpg IHC (Immunohiostchemistry) (Anti- EWSR1 Picoband antibody, AAA46491, IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- EWSR1 Picoband antibody, AAA46491, Western blottingAll lanes: Anti EWSR1 (AAA46491) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 95KD)

product-image-AAA46491_WB15.jpg WB (Western Blot) (Anti- EWSR1 Picoband antibody, AAA46491, Western blottingAll lanes: Anti EWSR1 (AAA46491) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 95KD)
Related Product Information for anti-EWSR1 antibody
Description: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
References
1. "Entrez Gene: EWSR1 Ewing sarcoma breakpoint region 1". 2. Delattre O, Zucman J, Plougastel B, Desmaze C, Melot T, Peter M, Kovar H, Joubert I, de Jong P, Rouleau G (October 1992). "Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours". Nature 359 (6391): 162-5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,508 Da
NCBI Official Full Name
RNA-binding protein EWS isoform 3
NCBI Official Synonym Full Names
EWS RNA binding protein 1
NCBI Official Symbol
EWSR1
NCBI Official Synonym Symbols
EWS; EWS-FLI1; bK984G1.4
NCBI Protein Information
RNA-binding protein EWS
UniProt Protein Name
RNA-binding protein EWS
UniProt Gene Name
EWSR1
UniProt Synonym Gene Names
EWS
UniProt Entry Name
EWS_HUMAN

Similar Products

Product Notes

The EWSR1 ewsr1 (Catalog #AAA46491) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-EWSR1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EWSR1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EWSR1 ewsr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EWSR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.