Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201244_IHC13.jpg IHC (Immunohiostchemistry) (IHC - Paraffin (10 ug/ml))

Rabbit anti-Human FADS2 Polyclonal Antibody | anti-FADS2 antibody

FADS2 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FADS2; D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FADS2, Antibody; FADS2 Antibody - middle region; anti-FADS2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKF
Sequence Length
444
Applicable Applications for anti-FADS2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FADS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohiostchemistry)

(IHC - Paraffin (10 ug/ml))

product-image-AAA201244_IHC13.jpg IHC (Immunohiostchemistry) (IHC - Paraffin (10 ug/ml))

IHC (Immunohistochemistry)

(IHC - Paraffin (10 ug/ml))

product-image-AAA201244_IHC15.jpg IHC (Immunohistochemistry) (IHC - Paraffin (10 ug/ml))
Related Product Information for anti-FADS2 antibody
fatty acid desaturase 2

Target Description: The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-FADS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
acyl-CoA 6-desaturase isoform 1
NCBI Official Synonym Full Names
fatty acid desaturase 2
NCBI Official Symbol
FADS2
NCBI Official Synonym Symbols
D6D; DES6; TU13; FADSD6; LLCDL2; SLL0262
NCBI Protein Information
acyl-CoA 6-desaturase
UniProt Protein Name
Fatty acid desaturase 2
UniProt Gene Name
FADS2
UniProt Synonym Gene Names
D6D; Delta(6) desaturase; Delta-6 desaturase

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FADS2 fads2 (Catalog #AAA201244) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FADS2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FADS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FADS2 fads2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFYFGNGWIP TLITAFVLAT SQAQAGWLQH DYGHLSVYRK PKWNHLVHKF. It is sometimes possible for the material contained within the vial of "FADS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.