Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282377_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Fam221a Rabbit pAb (AAA282377) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Fam221a Polyclonal Antibody | anti-Fam221a antibody

Fam221a Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
Fam221a; D330028D13Rik
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Fam221a, Antibody; Fam221a Rabbit pAb; D330028D13Rik; anti-Fam221a antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACSKCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNEVGPSTQLSSLRKPEEDDMAYFERQYQERIKLEKAAKQKGKV
Applicable Applications for anti-Fam221a antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Mouse testis, Rat testis
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of mouse Fam221a (NP_766315.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Fam221a Rabbit pAb (AAA282377) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282377_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Fam221a Rabbit pAb (AAA282377) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using Fam221a Rabbit pAb (AAA282377) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282377_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using Fam221a Rabbit pAb (AAA282377) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Fam221a antibody (AAA282377) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282377_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Fam221a antibody (AAA282377) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)
Related Product Information for anti-Fam221a antibody
Orthologous to human FAM221A (family with sequence similarity 221 member A).
Product Categories/Family for anti-Fam221a antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,335 Da
NCBI Official Full Name
protein FAM221A isoform 2
NCBI Official Synonym Full Names
family with sequence similarity 221, member A
NCBI Official Symbol
Fam221a
NCBI Official Synonym Symbols
D330028D13Rik
NCBI Protein Information
protein FAM221A
UniProt Protein Name
Protein FAM221A
UniProt Gene Name
Fam221a

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Fam221a fam221a (Catalog #AAA282377) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fam221a Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fam221a can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the Fam221a fam221a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERLTLPPGG AEAVDEYLEY RRIVGEDDGG KLFTPEEYEE YKKKVLPMRL QNRLFVSWRS PTGMDCKLVG PETLCFCTHR YKQHKTDFET IPQQRPIALP CRVSGCRCKA YHYVPLNGTQ PIRCRCKHFA DQHSAALGFT CNACSKCSGF HSCYTCACGQ PAYAHDTVVE TRQERLAQGK PVGRDVPYAA MGGLTGFSSL AEGYMRLDDS GIGAPSVEVL DSAVSAMDHP FLRAMHAPST SSPQPLAGGN EVGPSTQLSS LRKPEEDDMA YFERQYQERI KLEKAAKQKG KV. It is sometimes possible for the material contained within the vial of "Fam221a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.