Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200007_IP13.jpg IP (Immunoprecipitation) (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein is modified by glycosylation.)

Rabbit FAM62B Polyclonal Antibody | anti-ESYT2 antibody

FAM62B antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ESYT2; E-Syt2; FAM62B; CHR2SYT
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
FAM62B, Antibody; FAM62B antibody - middle region; E-Syt2, FAM62B, CHR2SYT; anti-ESYT2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Sequence Length
893
Applicable Applications for anti-ESYT2 antibody
IP (Immunoprecipitation), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM62B
Protein Size (# AA)
893 amino acids
Protein Interactions
SUMO2; MAPK15; FN1; ECT2; SLC25A17; UBC; SLC2A4; CAMKK2; CLN3
Blocking Peptide
FAM62B peptide ( ) is used for blocking the activity of FAM62B antibody (MBS3209511)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IP (Immunoprecipitation)

(25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein is modified by glycosylation.)

product-image-AAA200007_IP13.jpg IP (Immunoprecipitation) (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein is modified by glycosylation.)

WB (Western Blot)

(WB Suggested Anti-FAM62B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

product-image-AAA200007_WB15.jpg WB (Western Blot) (WB Suggested Anti-FAM62B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-ESYT2 antibody
This is a rabbit polyclonal antibody against FAM62B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAM62B may play a role as calcium-regulated intrinsic membrane protein.
Product Categories/Family for anti-ESYT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102 kDa
NCBI Official Full Name
extended synaptotagmin-2 isoform 2
NCBI Official Synonym Full Names
extended synaptotagmin 2
NCBI Official Symbol
ESYT2
NCBI Official Synonym Symbols
E-Syt2; FAM62B; CHR2SYT
NCBI Protein Information
extended synaptotagmin-2
UniProt Protein Name
Extended synaptotagmin-2
UniProt Gene Name
ESYT2
UniProt Synonym Gene Names
FAM62B; KIAA1228; E-Syt2
UniProt Entry Name
ESYT2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ESYT2 esyt2 (Catalog #AAA200007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM62B antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM62B can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the ESYT2 esyt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSGPNSTIKM KIALRVLHLE KRERPPDHQH SAQVKRPSVS KEGRKTSIKS. It is sometimes possible for the material contained within the vial of "FAM62B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.