Rabbit FBXL11 Polyclonal Antibody | anti-KDM2A antibody
FBXL11 antibody - N-terminal region
Gene Names
KDM2A; FBL7; CXXC8; FBL11; FBXL11; JHDM1A; LILINA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FBXL11, Antibody; FBXL11 antibody - N-terminal region; anti-KDM2A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF
Sequence Length
782
Applicable Applications for anti-KDM2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-KDM2A antibody
This is a rabbit polyclonal antibody against FBXL11. It was validated on Western Blot and immunohistochemistry
Target Description: FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats
Target Description: FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats
Product Categories/Family for anti-KDM2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
FBXL11 protein
NCBI Official Synonym Full Names
lysine demethylase 2A
NCBI Official Symbol
KDM2A
NCBI Official Synonym Symbols
FBL7; CXXC8; FBL11; FBXL11; JHDM1A; LILINA
NCBI Protein Information
lysine-specific demethylase 2A
UniProt Protein Name
Lysine-specific demethylase 2A
UniProt Gene Name
KDM2A
UniProt Synonym Gene Names
CXXC8; FBL7; FBXL11; JHDM1A; KIAA1004
UniProt Entry Name
KDM2A_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The KDM2A kdm2a (Catalog #AAA197216) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXL11 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KDM2A kdm2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIRYSQRLRG TMRRRYEDDG ISDDEIEGKR TFDLEEKLHT NKYNANFVTF. It is sometimes possible for the material contained within the vial of "FBXL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
