Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199530_WB15.jpg WB (Western Blot) (WB Suggested Anti-FCER1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit FCER1A Polyclonal Antibody | anti-FCER1A antibody

FCER1A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FCER1A; FCE1A; FcERI
Reactivity
Tested: Human
Predicted: Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCER1A, Antibody; FCER1A antibody - middle region; anti-FCER1A antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT
Sequence Length
257
Applicable Applications for anti-FCER1A antibody
WB (Western Blot)
Homology
Human: 100%; Rabbit: 85%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FCER1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FCER1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

product-image-AAA199530_WB15.jpg WB (Western Blot) (WB Suggested Anti-FCER1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-FCER1A antibody
This is a rabbit polyclonal antibody against FCER1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
high affinity immunoglobulin epsilon receptor subunit alpha
NCBI Official Synonym Full Names
Fc fragment of IgE receptor Ia
NCBI Official Symbol
FCER1A
NCBI Official Synonym Symbols
FCE1A; FcERI
NCBI Protein Information
high affinity immunoglobulin epsilon receptor subunit alpha
UniProt Protein Name
High affinity immunoglobulin epsilon receptor subunit alpha
UniProt Gene Name
FCER1A
UniProt Synonym Gene Names
FCE1A; FcERI
UniProt Entry Name
FCERA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FCER1A fcer1a (Catalog #AAA199530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCER1A antibody - middle region reacts with Tested: Human Predicted: Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FCER1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FCER1A fcer1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYYKDGEALK YWYENHNISI TNATVEDSGT YYCTGKVWQL DYESEPLNIT. It is sometimes possible for the material contained within the vial of "FCER1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.