Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199659_WB11.jpg WB (Western Blot) (WB Suggested Anti-FEN1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellFEN1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit FEN1 Polyclonal Antibody | anti-FEN1 antibody

FEN1 antibody - N-terminal region

Gene Names
FEN1; MF1; RAD2; FEN-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FEN1, Antibody; FEN1 antibody - N-terminal region; anti-FEN1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH
Sequence Length
380
Applicable Applications for anti-FEN1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FEN1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellFEN1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA199659_WB11.jpg WB (Western Blot) (WB Suggested Anti-FEN1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellFEN1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(WB Suggested Anti-FEN1 AntibodyPositive Control: Lane1: hFEN1 (1-336), Lane2: uninduced BL21, Lane3: 2h induced BL21, Lane4: overnight induced BL21Primary Antibody Dilution : 1:2000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Prof. Jon R Sayers, University of Sheffield Medical School)

product-image-AAA199659_WB13.jpg WB (Western Blot) (WB Suggested Anti-FEN1 AntibodyPositive Control: Lane1: hFEN1 (1-336), Lane2: uninduced BL21, Lane3: 2h induced BL21, Lane4: overnight induced BL21Primary Antibody Dilution : 1:2000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:10,000Submitted by: Prof. Jon R Sayers, University of Sheffield Medical School)

WB (Western Blot)

(Host: MouseTarget Name: FEN1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199659_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: FEN1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-FEN1 antibody
This is a rabbit polyclonal antibody against FEN1. It was validated on Western Blot

Target Description: FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
flap endonuclease 1
NCBI Official Synonym Full Names
flap structure-specific endonuclease 1
NCBI Official Symbol
FEN1
NCBI Official Synonym Symbols
MF1; RAD2; FEN-1
NCBI Protein Information
flap endonuclease 1
UniProt Protein Name
Flap endonuclease 1
UniProt Gene Name
FEN1
UniProt Synonym Gene Names
RAD2; FEN-1; MF1; hFEN-1
UniProt Entry Name
FEN1_HUMAN

Similar Products

Product Notes

The FEN1 fen1 (Catalog #AAA199659) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FEN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FEN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FEN1 fen1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APSAIRENDI KSYFGRKVAI DASMSIYQFL IAVRQGGDVL QNEEGETTSH. It is sometimes possible for the material contained within the vial of "FEN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.