Rabbit FERMT1 Polyclonal Antibody | anti-FERMT1 antibody
FERMT1 antibody - N-terminal region
Gene Names
FERMT1; URP1; KIND1; DTGCU2; UNC112A; C20orf42
Reactivity
Tested: HumanPredicted: Cow, Dog, Horse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FERMT1, Antibody; FERMT1 antibody - N-terminal region; anti-FERMT1 antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Horse, Rabbit, Rat
Predicted: Cow, Dog, Horse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
Sequence Length
677
Applicable Applications for anti-FERMT1 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FERMT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-FERMT1 antibody
This is a rabbit polyclonal antibody against FERMT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
Target Description: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
Product Categories/Family for anti-FERMT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
fermitin family homolog 1
NCBI Official Synonym Full Names
fermitin family member 1
NCBI Official Symbol
FERMT1
NCBI Official Synonym Symbols
URP1; KIND1; DTGCU2; UNC112A; C20orf42
NCBI Protein Information
fermitin family homolog 1
UniProt Protein Name
Fermitin family homolog 1
UniProt Gene Name
FERMT1
UniProt Synonym Gene Names
C20orf42; KIND1; URP1
UniProt Entry Name
FERM1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The FERMT1 fermt1 (Catalog #AAA199130) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FERMT1 antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Horse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FERMT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FERMT1 fermt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSSTDFTFAS WELVVRVDHP NEEQQKDVTL RVSGDLHVGG VMLKLVEQIN. It is sometimes possible for the material contained within the vial of "FERMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
