Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23383_WB8.jpg WB (Western Blot) (Host: Rabbit Target Name: FOSL1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml)

Rabbit FOSL1 Polyclonal Antibody | anti-FOSL1 antibody

FOSL1 antibody - middle region

Gene Names
FOSL1; FRA; FRA1; fra-1
Reactivity
Tested Species Reactivity Human, Rat
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FOSL1, Antibody; FOSL1 antibody - middle region; anti-FOSL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity Human, Rat
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
Sequence Length
271
Applicable Applications for anti-FOSL1 antibody
Immunohistochemistry (IHC), QC Western Blot (WB)
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 85%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FOSL1
Protein Size (# AA)
271 amino acids
Protein Interactions
NME7; CREB5; USF1; LDOC1; JUNB; MAFB; MAF; JUN; DDIT3; ATF2; CEBPG; CEBPE; CEBPA; ATF4; ATF3; PARVG; WFDC1; TAB2; ATXN1; MYC; KPNA1; PSMC3; EP300; CREBBP; TRIM24; UBC; HDAC1; CALCOCO1; ATF1; CREB1; SRF; ELK1;
Blocking Peptide
For anti-FOSL1 (AAA23383) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: Rabbit Target Name: FOSL1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml)

product-image-AAA23383_WB8.jpg WB (Western Blot) (Host: Rabbit Target Name: FOSL1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA23383_WB7.jpg WB (Western Blot) (WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RatTarget Name: FOSL1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23383_WB6.jpg WB (Western Blot) (Host: RatTarget Name: FOSL1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-FOSL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23383_IHC5.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOSL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-FOSL1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23383_IHC4.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOSL1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-FOSL1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23383_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOSL1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOSL1 antibody)

product-image-AAA23383_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOSL1 antibody)

IHC (Immunohistochemistry)

(Human Skin)

product-image-AAA23383_IHC.jpg IHC (Immunohistochemistry) (Human Skin)
Related Product Information for anti-FOSL1 antibody
Target Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
fos-related antigen 1 isoform 1
NCBI Official Synonym Full Names
FOS like 1, AP-1 transcription factor subunit
NCBI Official Symbol
FOSL1
NCBI Official Synonym Symbols
FRA; FRA1; fra-1
NCBI Protein Information
fos-related antigen 1
UniProt Protein Name
Fos-related antigen 1
UniProt Gene Name
FOSL1
UniProt Synonym Gene Names
FRA1; FRA-1
UniProt Entry Name
FOSL1_HUMAN

Similar Products

Product Notes

The FOSL1 fosl1 (Catalog #AAA23383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOSL1 antibody - middle region reacts with Tested Species Reactivity Human, Rat Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FOSL1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), QC Western Blot (WB). Researchers should empirically determine the suitability of the FOSL1 fosl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDFLQAETDK LEDEKSGLQR EIEELQKQKE RLELVLEAHR PICKIPEGAK. It is sometimes possible for the material contained within the vial of "FOSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.