Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23460_WB6.jpg WB (Western Blot) (WB Suggested Anti-FOXO3 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit FOXO3 Polyclonal Antibody | anti-FOXO3 antibody

FOXO3 antibody - N-terminal region

Gene Names
FOXO3; FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXO3, Antibody; FOXO3 antibody - N-terminal region; anti-FOXO3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGE
Sequence Length
673
Applicable Applications for anti-FOXO3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOXO3 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

product-image-AAA23460_WB6.jpg WB (Western Blot) (WB Suggested Anti-FOXO3 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23460_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23460_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23460_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: FOXO3Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOXO3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23460_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: FOXO3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-FOXO3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23460_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOXO3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FOXO3 antibody
This is a rabbit polyclonal antibody against FOXO3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXO3A belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
forkhead box protein O3
NCBI Official Synonym Full Names
forkhead box O3
NCBI Official Symbol
FOXO3
NCBI Official Synonym Symbols
FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
NCBI Protein Information
forkhead box protein O3
UniProt Protein Name
Forkhead box protein O3
UniProt Gene Name
FOXO3
UniProt Synonym Gene Names
FKHRL1; FOXO3A
UniProt Entry Name
FOXO3_HUMAN

Similar Products

Product Notes

The FOXO3 foxo3 (Catalog #AAA23460) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXO3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FOXO3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXO3 foxo3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAEAPASPAP LSPLEVELDP EFEPQSRPRS CTWPLQRPEL QASPAKPSGE. It is sometimes possible for the material contained within the vial of "FOXO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.