Rabbit FUS Polyclonal Antibody | anti-FUS antibody

FUS Rabbit pAb

Cat. Num. AAA28431

• Gene Names: MAFK; P18; NFE2U
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: FUS, Antibody; FUS Rabbit pAb; FUS; ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS; RNA-binding protein FUS; anti-FUS antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT

• Applicable Applications for anti-FUS antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200; IP: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1).
• Cellular Location: Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS at a dilution of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using FUS antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using FUS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

Related Product Information for anti-FUS antibody

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Product Categories/Family for anti-FUS antibody

Epigenetics & Nuclear Signaling; Transcription Factors; RNA Binding; Cancer; Signal Transduction; Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4505075
• NCBI GeneID: 7975
• NCBI Accession #: NP_002351.1
• NCBI GenBank Nucleotide #: NM_002360.3
• UniProt Accession #: O60675; A4D214
• Molecular Weight: 17,523 Da
• NCBI Official Full Name: transcription factor MafK
• NCBI Official Synonym Full Names: v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K
• NCBI Official Symbol: MAFK
• NCBI Official Synonym Symbols: P18; NFE2U
• NCBI Protein Information: transcription factor MafK; basic-leucine zipper transcription factor MafK; erythroid transcription factor NF-E2 p18 subunit; nuclear factor erythroid-2, ubiquitous (p18); v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K; v-maf muscul
• UniProt Protein Name: Transcription factor MafK
• UniProt Gene Name: MAFK
• UniProt Entry Name: MAFK_HUMAN