Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46433_IHC10.jpg IHC (Immunohistochemistry) (Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Human Mammary Cancer Tissue)

FUT1 Polyclonal Antibody | anti-FUT1 antibody

Anti-FUT1 Antibody

Gene Names
FUT1; H; HH; HSC
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FUT1, Antibody; Anti-FUT1 Antibody; Galactoside 2-alpha-L-fucosyltransferase 1; 2)FT 1; 2-alpha-L-fucosyltransferase; Alpha (1 2) fucosyltransferase; Alpha(1 2)FT 1; Alpha(1; Blood group H alpha 2-fucosyltransferase; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); Fucosyltransferase 1; FUT1; FUT1_HUMAN; Galactoside 2 alpha L fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; HH; HSC; Para Bombay phenotype; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); anti-FUT1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
365
Applicable Applications for anti-FUT1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46433_IHC10.jpg IHC (Immunohistochemistry) (Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46433_IHC11.jpg IHC (Immunohistochemisry) (Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46433_IHC13.jpg IHC (Immunohiostchemistry) (Anti- FUT1 Picoband antibody, AAA46433, IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- FUT1 Picoband antibody, AAA46433, Western blottingAll lanes: Anti FUT1 (AAA46433) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)

product-image-AAA46433_WB15.jpg WB (Western Blot) (Anti- FUT1 Picoband antibody, AAA46433, Western blottingAll lanes: Anti FUT1 (AAA46433) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)
Related Product Information for anti-FUT1 antibody
Description: Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human;Mouse; Rat.

Background: Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
References
1. "Entrez Gene: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)". 2. Ball SP, Tongue N, Gibaud A et al. (1992). "The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9". Ann. Hum. Genet. 55 (Pt 3): 225-33. 3. Yip SP, Chee KY, Chan PY et al. (2003). "Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified". Vox Sang. 83 (3): 258-62.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,251 Da
NCBI Official Full Name
galactoside 2-alpha-L-fucosyltransferase 1
NCBI Official Synonym Full Names
fucosyltransferase 1 (H blood group)
NCBI Official Symbol
FUT1
NCBI Official Synonym Symbols
H; HH; HSC
NCBI Protein Information
galactoside 2-alpha-L-fucosyltransferase 1
UniProt Protein Name
Galactoside 2-alpha-L-fucosyltransferase 1
UniProt Gene Name
FUT1
UniProt Synonym Gene Names
H; HSC
UniProt Entry Name
FUT1_HUMAN

Similar Products

Product Notes

The FUT1 fut1 (Catalog #AAA46433) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FUT1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FUT1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FUT1 fut1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FUT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.