WB (Western Blot)
(WB Suggested Anti-FUT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Rabbit FUT1 Polyclonal Antibody | anti-FUT1 antibody
FUT1 antibody - middle region
Gene Names
FUT1; H; HH; HSC
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FUT1, Antibody; FUT1 antibody - middle region; anti-FUT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
Sequence Length
365
Applicable Applications for anti-FUT1 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FUT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FUT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-FUT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Related Product Information for anti-FUT1 antibody
This is a rabbit polyclonal antibody against FUT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Target Description: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Product Categories/Family for anti-FUT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41
NCBI Official Full Name
galactoside 2-alpha-L-fucosyltransferase 1
NCBI Official Synonym Full Names
fucosyltransferase 1 (H blood group)
NCBI Official Symbol
FUT1
NCBI Official Synonym Symbols
H; HH; HSC
NCBI Protein Information
galactoside 2-alpha-L-fucosyltransferase 1
UniProt Protein Name
Galactoside 2-alpha-L-fucosyltransferase 1
UniProt Gene Name
FUT1
UniProt Synonym Gene Names
H; HSC
UniProt Entry Name
FUT1_HUMAN
Similar Products
Product Notes
The FUT1 fut1 (Catalog #AAA199398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUT1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FUT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FUT1 fut1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EATPWKDFAL LTQCNHTIMT IGTFGFWAAY LAGGDTVYLA NFTLPDSEFL. It is sometimes possible for the material contained within the vial of "FUT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.