IHC (Immunohiostchemistry)
(G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)
Rabbit G22P1 Polyclonal Antibody | anti-G22P1 antibody
G22P1 antibody
Gene Names
XRCC6; ML8; KU70; TLAA; CTC75; CTCBF; G22P1
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
G22P1, Antibody; G22P1 antibody; Polyclonal G22P1; Anti-G22P1; GP1-22; GP1 22; G22P1; ATP dependent DNA helicase 2 subunit 1; anti-G22P1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
G22P1 antibody was raised against the N terminal Of G22P1
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of G22P1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
227
Applicable Applications for anti-G22P1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Cross-Reactivity
Human
Immunogen
G22P1 antibody was raised using the N terminal Of G22P1 corresponding to a region with amino acids NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
IHC (Immunohiostchemistry)
(G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)
IHC (Immunohiostchemistry)
(G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)
WB (Western Blot)
(G22P1 antibody (AAA108295) used at 0.6 ug/ml to detect target protein.)
WB (Western Blot)
(G22P1 antibody (AAA108295) used at 0.6 ug/ml to detect target protein.)
Related Product Information for anti-G22P1 antibody
Rabbit polyclonal G22P1 antibody raised against the N terminal Of G22P1
Product Categories/Family for anti-G22P1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
70 kDa (MW of target protein)
NCBI Official Full Name
G22P1
NCBI Official Synonym Full Names
X-ray repair complementing defective repair in Chinese hamster cells 6
NCBI Official Symbol
XRCC6
NCBI Official Synonym Symbols
ML8; KU70; TLAA; CTC75; CTCBF; G22P1
NCBI Protein Information
X-ray repair cross-complementing protein 6
UniProt Protein Name
G22P1 protein
UniProt Gene Name
G22P1
UniProt Entry Name
Q6IC76_HUMAN
Similar Products
Product Notes
The G22P1 g22p1 (Catalog #AAA108295) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's G22P1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the G22P1 g22p1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "G22P1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.