Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198206_WB8.jpg WB (Western Blot) (WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateG3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Rabbit G3BP1 Polyclonal Antibody | anti-G3BP1 antibody

G3BP1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
G3BP1; G3BP; HDH-VIII
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Affinity Purified
Synonyms
G3BP1, Antibody; G3BP1 antibody - N-terminal region; anti-G3BP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
Sequence Length
466
Applicable Applications for anti-G3BP1 antibody
WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateG3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

product-image-AAA198206_WB8.jpg WB (Western Blot) (WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateG3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

WB (Western Blot)

(Lanes:1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:G3BP1Submitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA198206_WB10.jpg WB (Western Blot) (Lanes:1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:G3BP1Submitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IP (Immunoprecipitation)

(IP Suggested Anti-G3BP1 AntibodyPositive Control: NT2 CELL/BRAIN TISSUE)

product-image-AAA198206_IP11.jpg IP (Immunoprecipitation) (IP Suggested Anti-G3BP1 AntibodyPositive Control: NT2 CELL/BRAIN TISSUE)

IP (Immunoprecipitation)

(Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :G3BP1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :G3BP1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA198206_IP13.jpg IP (Immunoprecipitation) (Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :G3BP1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :G3BP1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Rabbit Anti-G3BP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198206_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-G3BP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-G3BP1 antibody
This is a rabbit polyclonal antibody against G3BP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
ras GTPase-activating protein-binding protein 1
NCBI Official Synonym Full Names
G3BP stress granule assembly factor 1
NCBI Official Symbol
G3BP1
NCBI Official Synonym Symbols
G3BP; HDH-VIII
NCBI Protein Information
ras GTPase-activating protein-binding protein 1
UniProt Protein Name
Ras GTPase-activating protein-binding protein 1
UniProt Gene Name
G3BP1
UniProt Synonym Gene Names
G3BP; G3BP-1; hDH VIII
UniProt Entry Name
G3BP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The G3BP1 g3bp1 (Catalog #AAA198206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The G3BP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's G3BP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the G3BP1 g3bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFMQTFVLAP EGSVANKFYV HNDIFRYQDE VFGGFVTEPQ EESEEEVEEP. It is sometimes possible for the material contained within the vial of "G3BP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.