Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199399_WB10.jpg WB (Western Blot) (WB Suggested Anti-G6pc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)

Rabbit G6pc Polyclonal Antibody | anti-G6PC antibody

G6pc antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
G6pc; G6pt; G6Pase; AW107337; Glc-6-Pase
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
G6pc, Antibody; G6pc antibody - N-terminal region; anti-G6PC antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
Sequence Length
357
Applicable Applications for anti-G6PC antibody
WB (Western Blot)
Protein Size (# AA)
357 amino acids
Protein Interactions
Ppargc1a; Foxo1; Sirt1;
Blocking Peptide
For anti-G6pc ( ) antibody is Catalog MBS3232230
Predicted Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-G6pc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)

product-image-AAA199399_WB10.jpg WB (Western Blot) (WB Suggested Anti-G6pc AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)

WB (Western Blot)

(Host: RabbitTarget Name: G6PCSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199399_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: G6PCSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: G6PCSample Tissue: Mouse Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA199399_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: G6PCSample Tissue: Mouse Mouse LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: G6pcSample Tissue: Mouse LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199399_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: G6pcSample Tissue: Mouse LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-G6PC antibody
This is a rabbit polyclonal antibody against G6pc. It was validated on Western Blot

Target Description: G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
Product Categories/Family for anti-G6PC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
glucose-6-phosphatase
NCBI Official Synonym Full Names
glucose-6-phosphatase, catalytic
NCBI Official Symbol
G6pc
NCBI Official Synonym Symbols
G6pt; G6Pase; AW107337; Glc-6-Pase
NCBI Protein Information
glucose-6-phosphatase
UniProt Protein Name
Glucose-6-phosphatase
UniProt Gene Name
G6pc
UniProt Synonym Gene Names
G6pt; G-6-Pase; G6Pase

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The G6PC g6pc (Catalog #AAA199399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The G6pc antibody - N-terminal region reacts with Tested Reactivity: Mouse Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's G6pc can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the G6PC g6pc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFGIQSTRYL QVNYQDSQDW FILVSVIADL RNAFYVLFPI WFHLKETVGI. It is sometimes possible for the material contained within the vial of "G6pc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.