Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199400_WB11.jpg WB (Western Blot) (WB Suggested Anti-G6PC Antibody Titration: 1 ug/mlPositive Control: Fetal Lung cell lysate)

Rabbit G6PC Polyclonal Antibody | anti-G6PC antibody

G6PC antibody - N-terminal region

Gene Names
G6PC; G6PT; GSD1; G6PC1; GSD1a; G6Pase
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
G6PC, Antibody; G6PC antibody - N-terminal region; anti-G6PC antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and and may contain up to 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Sequence Length
357
Applicable Applications for anti-G6PC antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-G6PC Antibody Titration: 1 ug/mlPositive Control: Fetal Lung cell lysate)

product-image-AAA199400_WB11.jpg WB (Western Blot) (WB Suggested Anti-G6PC Antibody Titration: 1 ug/mlPositive Control: Fetal Lung cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: G6PCSample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA199400_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: G6PCSample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human kidney lysate tissue)

product-image-AAA199400_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human kidney lysate tissue)
Related Product Information for anti-G6PC antibody
This is a rabbit polyclonal antibody against G6PC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
glucose-6-phosphatase isoform 1
NCBI Official Synonym Full Names
glucose-6-phosphatase catalytic subunit
NCBI Official Symbol
G6PC
NCBI Official Synonym Symbols
G6PT; GSD1; G6PC1; GSD1a; G6Pase
NCBI Protein Information
glucose-6-phosphatase
UniProt Protein Name
Glucose-6-phosphatase
UniProt Gene Name
G6PC
UniProt Synonym Gene Names
G6PT; G-6-Pase; G6Pase
UniProt Entry Name
G6PC_HUMAN

Similar Products

Product Notes

The G6PC g6pc (Catalog #AAA199400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The G6PC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's G6PC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the G6PC g6pc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLVFKWILFG QRPYWWVLDT DYYSNTSVPL IKQFPVTCET GPGSPSGHAM. It is sometimes possible for the material contained within the vial of "G6PC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.