Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197913_WB8.jpg WB (Western Blot) (WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit GABRR2 Polyclonal Antibody | anti-GABRR2 antibody

GABRR2 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GABRR2, Antibody; GABRR2 antibody - middle region; anti-GABRR2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
Sequence Length
490
Applicable Applications for anti-GABRR2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GABRR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

product-image-AAA197913_WB8.jpg WB (Western Blot) (WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: GABRR2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA197913_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRR2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRR2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA197913_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRR2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRR2Sample Type: 293TAntibody Dilution: 1.0ug/mlGABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA197913_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRR2Sample Type: 293TAntibody Dilution: 1.0ug/mlGABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T)

IHC (Immunohistochemistry)

(Rabbit Anti-GABRR2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Membrane(tight junctions - intercalated disks)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5-2.0 secProtocol located in Reviews and Data.)

product-image-AAA197913_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-GABRR2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Membrane(tight junctions - intercalated disks)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5-2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-GABRR2 antibody
This is a rabbit polyclonal antibody against GABRR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 BX490975.1 60-89 31-1586 BC130352.1 1-1556 1587-1631 M86868.1 1584-1628
Product Categories/Family for anti-GABRR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit rho-2
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor rho2 subunit
NCBI Official Symbol
GABRR2
NCBI Protein Information
gamma-aminobutyric acid receptor subunit rho-2
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit rho-2
UniProt Gene Name
GABRR2
UniProt Entry Name
GBRR2_HUMAN

Similar Products

Product Notes

The GABRR2 gabrr2 (Catalog #AAA197913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRR2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GABRR2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GABRR2 gabrr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNKSMTFDGR LVKKIWVPDV FFVHSKRSFT HDTTTDNIML RVFPDGHVLY. It is sometimes possible for the material contained within the vial of "GABRR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.