Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46748_IHC10.jpg IHC (Immunohistochemistry) (GAD65 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit GAD65 Polyclonal Antibody | anti-GAD2 antibody

Anti-GAD65 Antibody

Average rating 0.0
No ratings yet
Gene Names
GAD2; GAD65
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
GAD65, Antibody; Anti-GAD65 Antibody; 4.1.1.15; 65 kDa glutamic acid decarboxylase; DCE 2; DCE2; GAD 2; GAD 65; GAD2; GAD-2; GAD65; GAD-65; Glutamate decarboxylase 2; Glutamate Decarboxylase 65; Q05329; glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa); anti-GAD2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
585
Applicable Applications for anti-GAD2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(GAD65 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46748_IHC10.jpg IHC (Immunohistochemistry) (GAD65 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(GAD65 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46748_IHC11.jpg IHC (Immunohistochemisry) (GAD65 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(GAD65 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46748_IHC13.jpg IHC (Immunohiostchemistry) (GAD65 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of GAD65 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). GAD65 at 65KD was detected using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46748_WB15.jpg WB (Western Blot) (Western blot analysis of GAD65 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). GAD65 at 65KD was detected using rabbit anti- GAD65 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-GAD2 antibody
Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection.
Background: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
References
1. "Entrez Gene: GAD2 glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)".
2. Meyre, D., Boutin, P., Tounian, A., Deweirder, M., Aout, M., Jouret, B., Heude, B., Weill, J., Tauber, M., Tounian, P., Froguel, P. Is glutamate decarboxylase 2 (GAD2) a genetic link between low birth weight and subsequent development of obesity in children?J. Clin. Endocr. Metab. 90: 2384-2390, 2005.
3. Zhang, Z., Cai, Y. Q., Zou, F., Bie, B., Pan, Z. Z. Epigenetic suppression of GAD65 expression mediates persistent pain. Nature Med. 17: 1448-1455, 2011.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,411 Da
NCBI Official Full Name
glutamate decarboxylase 2
NCBI Official Synonym Full Names
glutamate decarboxylase 2
NCBI Official Symbol
GAD2
NCBI Official Synonym Symbols
GAD65
NCBI Protein Information
glutamate decarboxylase 2
UniProt Protein Name
Glutamate decarboxylase 2
UniProt Gene Name
GAD2
UniProt Synonym Gene Names
GAD65; GAD-65

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GAD2 gad2 (Catalog #AAA46748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GAD65 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAD65 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GAD2 gad2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAD65, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.