Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198240_WB13.jpg WB (Western Blot) (WB Suggested Anti-GATA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit GATA4 Polyclonal Antibody | anti-GATA4 antibody

GATA4 antibody - N-terminal region

Gene Names
GATA4; TOF; ASD2; VSD1; TACHD
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GATA4, Antibody; GATA4 antibody - N-terminal region; anti-GATA4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLG
Sequence Length
442
Applicable Applications for anti-GATA4 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GATA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GATA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

product-image-AAA198240_WB13.jpg WB (Western Blot) (WB Suggested Anti-GATA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Lanes:1: 25 ug mouse tumor + shRNA1, 2: 25 ug mouse tumor + shRNA2, 3: 25 ug mouse tumor + shRNA3 4: 25 ug mouse tumor lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:3500Gene Name:GATA4Submitted by:Dr. Jonahan Kurie, UT MD Anderson Cancer center)

product-image-AAA198240_WB15.jpg WB (Western Blot) (Lanes:1: 25 ug mouse tumor + shRNA1, 2: 25 ug mouse tumor + shRNA2, 3: 25 ug mouse tumor + shRNA3 4: 25 ug mouse tumor lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:3500Gene Name:GATA4Submitted by:Dr. Jonahan Kurie, UT MD Anderson Cancer center)
Related Product Information for anti-GATA4 antibody
This is a rabbit polyclonal antibody against GATA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GATA4 is a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. GATA4is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transcription factor GATA-4 isoform 2
NCBI Official Synonym Full Names
GATA binding protein 4
NCBI Official Symbol
GATA4
NCBI Official Synonym Symbols
TOF; ASD2; VSD1; TACHD
NCBI Protein Information
transcription factor GATA-4

Similar Products

Product Notes

The GATA4 (Catalog #AAA198240) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA4 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GATA4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GATA4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYQSLAMAAN HGPPPGAYEA GGPGAFMHGA GAASSPVYVP TPRVPSSVLG. It is sometimes possible for the material contained within the vial of "GATA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.