Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28338_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Gelsolin Polyclonal Antibody | anti-GSN antibody

Gelsolin Rabbit pAb

Gene Names
GSN; ADF; AGEL
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
Gelsolin, Antibody; Gelsolin Rabbit pAb; GSN; ADF; AGEL; gelsolin; anti-GSN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
PMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Applicable Applications for anti-GSN antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 543-782 of human Gelsolin (NP_000168.1).
Cellular Location
Cytoplasm, Secreted, cytoskeleton
Positive Samples
A-549, Mouse lung, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28338_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28338_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28338_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

product-image-AAA28338_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

product-image-AAA28338_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

product-image-AAA28338_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

product-image-AAA28338_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using Gelsolin Rabbit pAb at dilution of 1:50 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Gelsolin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28338_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Gelsolin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-GSN antibody
Background: The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
782
NCBI Official Full Name
Gelsolin
NCBI Official Synonym Full Names
gelsolin
NCBI Official Symbol
GSN
NCBI Official Synonym Symbols
ADF; AGEL
NCBI Protein Information
gelsolin; brevin; actin-depolymerizing factor
UniProt Protein Name
Gelsolin
UniProt Gene Name
GSN
UniProt Synonym Gene Names
ADF
UniProt Entry Name
GELS_HUMAN

Similar Products

Product Notes

The GSN gsn (Catalog #AAA28338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gelsolin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Gelsolin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the GSN gsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PMIIYKGGTS REGGQTAPAS TRLFQVRANS AGATRAVEVL PKAGALNSND AFVLKTPSAA YLWVGTGASE AEKTGAQELL RVLRAQPVQV AEGSEPDGFW EALGGKAAYR TSPRLKDKKM DAHPPRLFAC SNKIGRFVIE EVPGELMQED LATDDVMLLD TWDQVFVWVG KDSQEEEKTE ALTSAKRYIE TDPANRDRRT PITVVKQGFE PPSFVGWFLG WDDDYWSVDP LDRAMAELAA. It is sometimes possible for the material contained within the vial of "Gelsolin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.