Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23457_WB6.jpg WB (Western Blot) (WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateGJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit GJA4 Polyclonal Antibody | anti-GJA4 antibody

GJA4 antibody - middle region

Gene Names
GJA4; CX37
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GJA4, Antibody; GJA4 antibody - middle region; anti-GJA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
Sequence Length
333
Applicable Applications for anti-GJA4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GJA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateGJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23457_WB6.jpg WB (Western Blot) (WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateGJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: GJA4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23457_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJA4Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA23457_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA4Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJA4Sample Type: HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23457_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA4Sample Type: HelaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJA4Sample Type: 721_BAntibody Dilution: 1.0ug/ml)

product-image-AAA23457_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA4Sample Type: 721_BAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GJA4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane in alveolar type I cells and macrophagesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23457_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-GJA4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane in alveolar type I cells and macrophagesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GJA4 antibody
This is a rabbit polyclonal antibody against GJA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GJA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
gap junction alpha-4 protein
NCBI Official Synonym Full Names
gap junction protein alpha 4
NCBI Official Symbol
GJA4
NCBI Official Synonym Symbols
CX37
NCBI Protein Information
gap junction alpha-4 protein
UniProt Protein Name
Gap junction alpha-4 protein
UniProt Gene Name
GJA4
UniProt Synonym Gene Names
Cx37
UniProt Entry Name
CXA4_HUMAN

Similar Products

Product Notes

The GJA4 gja4 (Catalog #AAA23457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJA4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GJA4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GJA4 gja4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKEGELRALP AKDPQVERAL AAVERQMAKI SVAEDGRLRI RGALMGTYVA. It is sometimes possible for the material contained within the vial of "GJA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.