Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198098_WB13.jpg WB (Western Blot) (WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit GJB2 Polyclonal Antibody | anti-GJB2 antibody

GJB2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GJB2; HID; KID; PPK; CX26; DFNA3; DFNB1; NSRD1; DFNA3A; DFNB1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
GJB2, Antibody; GJB2 antibody - middle region; anti-GJB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Sequence Length
226
Applicable Applications for anti-GJB2 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

product-image-AAA198098_WB13.jpg WB (Western Blot) (WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

WB (Western Blot)

(WB Suggested Anti-GJB2 AntibodyPositive Control: Lane 1: 4ug mCx26 elution fraction 6Lane 2: 4ug mCx26 elution fraction 7Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibodyLane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibodyPrimary Antibody Dilution : 1:3000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Juan Zou, Georgia state unviersity)

product-image-AAA198098_WB15.jpg WB (Western Blot) (WB Suggested Anti-GJB2 AntibodyPositive Control: Lane 1: 4ug mCx26 elution fraction 6Lane 2: 4ug mCx26 elution fraction 7Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibodyLane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibodyPrimary Antibody Dilution : 1:3000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Juan Zou, Georgia state unviersity)
Related Product Information for anti-GJB2 antibody
This is a rabbit polyclonal antibody against GJB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
Product Categories/Family for anti-GJB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
gap junction beta-2 protein
NCBI Official Synonym Full Names
gap junction protein beta 2
NCBI Official Symbol
GJB2
NCBI Official Synonym Symbols
HID; KID; PPK; CX26; DFNA3; DFNB1; NSRD1; DFNA3A; DFNB1A
NCBI Protein Information
gap junction beta-2 protein
UniProt Protein Name
Gap junction beta-2 protein
UniProt Gene Name
GJB2
UniProt Synonym Gene Names
Cx26
UniProt Entry Name
CXB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GJB2 gjb2 (Catalog #AAA198098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GJB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GJB2 gjb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STPALLVAMH VAYRRHEKKR KFIKGEIKSE FKDIEEIKTQ KVRIEGSLWW. It is sometimes possible for the material contained within the vial of "GJB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.