WB (Western Blot)
(WB Suggested Antibody Titration: 2.5ug/mlPositive Control: HepG2GLS2 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit GLS2 Polyclonal Antibody | anti-GLS2 antibody
GLS2 antibody - middle region
Gene Names
GLS2; GA; GLS; LGA; hLGA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GLS2, Antibody; GLS2 antibody - middle region; anti-GLS2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Sequence Length
327
Applicable Applications for anti-GLS2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GLS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Antibody Titration: 2.5ug/mlPositive Control: HepG2GLS2 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Antibody Titration: 2.5ug/mlPositive Control: HepG2GLS2 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(Host: RabbitTarget Name: GLS2Sample Tissue: Human NCI-H226Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GLS2Sample Tissue: Human NCI-H226Antibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-GLS2 antibody
This is a rabbit polyclonal antibody against GLS2. It was validated on Western Blot and immunohistochemistry
Target Description: GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Target Description: GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Product Categories/Family for anti-GLS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
glutaminase 2 (liver, mitochondrial), isoform CRA_a
NCBI Official Synonym Full Names
glutaminase 2
NCBI Official Symbol
GLS2
NCBI Official Synonym Symbols
GA; GLS; LGA; hLGA
NCBI Protein Information
glutaminase liver isoform, mitochondrial
UniProt Protein Name
Glutaminase liver isoform, mitochondrial
UniProt Gene Name
GLS2
UniProt Synonym Gene Names
GA; GLS
UniProt Entry Name
GLSL_HUMAN
Similar Products
Product Notes
The GLS2 gls2 (Catalog #AAA199280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLS2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GLS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GLS2 gls2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVGKEPSGLR YNKLSLNEEG IPHNPMVNAG AIVVSSLIKM DCNKAEKFDF. It is sometimes possible for the material contained within the vial of "GLS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.