Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23521_WB13.jpg WB (Western Blot) (lanes 5: rat kidney cordexlanes 6: rat kidney proximal tubules prepped from cortexlanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysatelanes 8: rat brain supernatant)

Rabbit GLUD1 Polyclonal Antibody | anti-GLUD1 antibody

GLUD1 antibody - N-terminal region

Gene Names
GLUD1; GDH; GDH1; GLUD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GLUD1, Antibody; GLUD1 antibody - N-terminal region; anti-GLUD1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
Sequence Length
558
Applicable Applications for anti-GLUD1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(lanes 5: rat kidney cordexlanes 6: rat kidney proximal tubules prepped from cortexlanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysatelanes 8: rat brain supernatant)

product-image-AAA23521_WB13.jpg WB (Western Blot) (lanes 5: rat kidney cordexlanes 6: rat kidney proximal tubules prepped from cortexlanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysatelanes 8: rat brain supernatant)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23521_WB12.jpg WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23521_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlGLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA23521_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlGLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23521_WB9.jpg WB (Western Blot) (Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GLUD1Sample Type: Human Fetal LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA23521_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: GLUD1Sample Type: Human Fetal LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: GLUD1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23521_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: GLUD1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GLUD1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23521_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: GLUD1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GLUD1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23521_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GLUD1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(GLUD1 antibody - N-terminal region validated by WB using Fetal Liver Lysate at 1ug/ml.)

product-image-AAA23521_WB4.jpg WB (Western Blot) (GLUD1 antibody - N-terminal region validated by WB using Fetal Liver Lysate at 1ug/ml.)

IHC (Immunohistochemistry)

(Immunohistochemistry with pFA fixed human pancreas tissue tissue)

product-image-AAA23521_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry with pFA fixed human pancreas tissue tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with pFa fixed human brain tissue.)

product-image-AAA23521_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with pFa fixed human brain tissue.)

IHC (Immunohistochemistry)

(Immunohistochemistry with cortex/kidney tissue)

product-image-AAA23521_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with cortex/kidney tissue)
Related Product Information for anti-GLUD1 antibody
This is a rabbit polyclonal antibody against GLUD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
glutamate dehydrogenase 1, mitochondrial isoform a
NCBI Official Synonym Full Names
glutamate dehydrogenase 1
NCBI Official Symbol
GLUD1
NCBI Official Synonym Symbols
GDH; GDH1; GLUD
NCBI Protein Information
glutamate dehydrogenase 1, mitochondrial
UniProt Protein Name
Lengsin
UniProt Gene Name
LGSN
UniProt Synonym Gene Names
GLULD1; LGS
UniProt Entry Name
LGSN_HUMAN

Similar Products

Product Notes

The GLUD1 lgsn (Catalog #AAA23521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLUD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GLUD1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GLUD1 lgsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKAGVKINPK NYTDNELEKI TRRFTMELAK KGFIGPGIDV PAPDMSTGER. It is sometimes possible for the material contained within the vial of "GLUD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.