Rabbit glycine receptor, alpha 3 Polyclonal Antibody | anti-GLRA3 antibody
Rabbit anti-human glycine receptor, alpha 3 polyclonal Antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Purity
Antigen Affinity Purified
Synonyms
glycine receptor, alpha 3, Antibody; Rabbit anti-human glycine receptor, alpha 3 polyclonal Antibody; glycine receptor; alpha 3;; anti-GLRA3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Antigen Affinity Purified
Sequence Positions
28-254
Sequence
KETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLES FGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGY
Applicable Applications for anti-GLRA3 antibody
WB (Western Blot), ELISA
Immunogen Species
Homo sapiens (Human)
Target Names
GLRA3
Storage Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C. Avoid freeze / thaw cycles.
Santa Cruz Alternative
Potential replacement for Santa Cruz Biotechnology antibody catalog# sc-17282
Preparation and Storage
Upon receipt store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Glycine receptor, alpha 3
NCBI Official Synonym Full Names
glycine receptor, alpha 3
NCBI Official Symbol
GLRA3
NCBI Protein Information
glycine receptor subunit alpha-3; ligand gated ion channel; glycine receptor, alpha-3 polypeptide
UniProt Protein Name
Glycine receptor subunit alpha-3
UniProt Gene Name
GLRA3
UniProt Entry Name
GLRA3_HUMAN
Similar Products
Product Notes
The GLRA3 glra3 (Catalog #AAA81318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-254. The Rabbit anti-human glycine receptor, alpha 3 polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's glycine receptor, alpha 3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the GLRA3 glra3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KETDSARSRS APMSPSDFLD KLMGRTSGYD ARIRPNFKGP PVNVTCNIFI NSFGSIAETT MDYRVNIFLR QKWNDPRLAY SEYPDDSLDL DPSMLDSIWK PDLFFANEKG ANFHEVTTDN KLLRIFKNGN VLYSIRLTLT LSCPMDLKNF PMDVQTCIMQ LES FGYTMNDLIF EWQDEAPVQV AEGLTLPQFL LKEEKDLRYC TKHYNTGKFT CIEVRFHLER QMGY. It is sometimes possible for the material contained within the vial of "glycine receptor, alpha 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.