Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200876_WB10.jpg WB (Western Blot) (WB Suggested Anti-GNAI3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit GNAI3 Polyclonal Antibody | anti-GNAI3 antibody

GNAI3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GNAI3; 87U6; ARCND1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNAI3, Antibody; GNAI3 antibody - middle region; anti-GNAI3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY
Sequence Length
354
Applicable Applications for anti-GNAI3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAI3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GNAI3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA200876_WB10.jpg WB (Western Blot) (WB Suggested Anti-GNAI3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: GNAI3Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200876_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: GNAI3Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GNAI2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA200876_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: GNAI2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

product-image-AAA200876_WB15.jpg WB (Western Blot) (Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)
Related Product Information for anti-GNAI3 antibody
This is a rabbit polyclonal antibody against GNAI3. It was validated on Western Blot

Target Description: GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.
Product Categories/Family for anti-GNAI3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(k) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha i3
NCBI Official Symbol
GNAI3
NCBI Official Synonym Symbols
87U6; ARCND1
NCBI Protein Information
guanine nucleotide-binding protein G(k) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(k) subunit alpha
UniProt Gene Name
GNAI3
UniProt Entry Name
GNAI3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GNAI3 gnai3 (Catalog #AAA200876) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAI3 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAI3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNAI3 gnai3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTGIVETHFT FKDLYFKMFD VGGQRSERKK WIHCFEGVTA IIFCVALSDY. It is sometimes possible for the material contained within the vial of "GNAI3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.