Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA19465_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of SiHa cells using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).Overlay histogram showing SiHa cells stained with AAA19465 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit anti-Human GPCR RDC1/CXCR-7/ACKR3 Polyclonal Antibody | anti-ACKR3 antibody

Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband

Gene Names
CXCR7; RDC1; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
GPCR RDC1/CXCR-7/ACKR3, Antibody; Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband; anti-ACKR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-ACKR3 antibody
Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
WB: 0.25-0.5 ug/ml, Human
IHC-P: 2-5 ug/ml, Human
FC/FACS: 1-3 ug/1x10^6 cells, Human
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P).
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human GPCR RDC1/CXCR-7/ACKR3 (RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of SiHa cells using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).Overlay histogram showing SiHa cells stained with AAA19465 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19465_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of SiHa cells using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).Overlay histogram showing SiHa cells stained with AAA19465 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19465_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human urothelial carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19465_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human urothelial carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human endometrial cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19465_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human endometrial cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human colon adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19465_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human colon adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19465_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-GPCR RDC1/CXCR-7/ACKR3 Antibody (AAA19465) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human RT4 whole cell lysates,Lane 2: human Hela whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR RDC1/CXCR-7/ACKR3 antigen affinity purified polyclonal antibody (#AAA19465) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR RDC1/CXCR-7/ACKR3 at approximately 41 kDa. The expected band size for GPCR RDC1/CXCR-7/ACKR3 is at 41 kDa.)

product-image-AAA19465_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody (AAA19465).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human RT4 whole cell lysates,Lane 2: human Hela whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR RDC1/CXCR-7/ACKR3 antigen affinity purified polyclonal antibody (#AAA19465) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR RDC1/CXCR-7/ACKR3 at approximately 41 kDa. The expected band size for GPCR RDC1/CXCR-7/ACKR3 is at 41 kDa.)
Related Product Information for anti-ACKR3 antibody
Atypical chemokine receptor 3 also known as C-X-C chemokine receptor type 7 (CXCR-7) and G-protein coupled receptor 159 (GPR159) is a protein that in humans is encoded by the ACKR3 gene. This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
Product Categories/Family for anti-ACKR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,493 Da
NCBI Official Full Name
C-X-C chemokine receptor type 7
NCBI Official Synonym Full Names
chemokine (C-X-C motif) receptor 7
NCBI Official Symbol
CXCR7
NCBI Official Synonym Symbols
RDC1; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159
NCBI Protein Information
C-X-C chemokine receptor type 7; G protein-coupled receptor; chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog
UniProt Protein Name
C-X-C chemokine receptor type 7
UniProt Gene Name
CXCR7
UniProt Synonym Gene Names
CMKOR1; GPR159; RDC1; CXC-R7; CXCR-7; RDC-1
UniProt Entry Name
CXCR7_HUMAN

Similar Products

Product Notes

The ACKR3 cxcr7 (Catalog #AAA19465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPCR RDC1/CXCR-7/ACKR3 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Western Blot (WB). WB: 0.25-0.5 ug/ml, Human IHC-P: 2-5 ug/ml, Human FC/FACS: 1-3 ug/1x10^6 cells, Human Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P). Researchers should empirically determine the suitability of the ACKR3 cxcr7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPCR RDC1/CXCR-7/ACKR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.