Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201352_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-GPR85 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Brain, CortexPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit anti-Human GPR85 Polyclonal Antibody | anti-GPR85 antibody

GPR85 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GPR85; SREB; SREB2
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GPR85, Antibody; GPR85 Antibody - N-terminal region; anti-GPR85 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF
Sequence Length
370
Applicable Applications for anti-GPR85 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Predicted Species Reactivity
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR85
Protein Size
370 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohistochemisry)

(Rabbit Anti-GPR85 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Brain, CortexPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA201352_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-GPR85 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Brain, CortexPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

WB (Western Blot)

(WB Suggested Anti-GPR85 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellGPR85 is supported by BioGPS gene expression data to be expressed in NCIH226)

product-image-AAA201352_WB13.jpg WB (Western Blot) (WB Suggested Anti-GPR85 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellGPR85 is supported by BioGPS gene expression data to be expressed in NCIH226)

WB (Western Blot)

(Host: RabbitTarget Name: GPR85Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA201352_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: GPR85Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPR85 antibody
Target Description: Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins.
Product Categories/Family for anti-GPR85 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
probable G-protein coupled receptor 85
NCBI Official Synonym Full Names
G protein-coupled receptor 85
NCBI Official Symbol
GPR85
NCBI Official Synonym Symbols
SREB; SREB2
NCBI Protein Information
probable G-protein coupled receptor 85
UniProt Protein Name
Probable G-protein coupled receptor 85
UniProt Gene Name
GPR85
UniProt Synonym Gene Names
SREB2
UniProt Entry Name
GPR85_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPR85 gpr85 (Catalog #AAA201352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR85 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR85 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GPR85 gpr85 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFLLDLCCSD ILRSAICFPF VFNSVKNGST WTYGTLTCKV IAFLGVLSCF. It is sometimes possible for the material contained within the vial of "GPR85, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.