Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201723_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: GRIA2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit GRIA2 Polyclonal Antibody | anti-GRIA2 antibody

GRIA2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GRIA2; GLUR2; GLURB; GluA2; HBGR2; GluR-K2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry
Purity
Protein A purified
Synonyms
GRIA2, Antibody; GRIA2 antibody - N-terminal region; anti-GRIA2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
Sequence Length
883
Applicable Applications for anti-GRIA2 antibody
IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: MouseTarget Name: GRIA2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA201723_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: GRIA2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Mouse Gut TissuePrimaryDilution: 20ug/mL and 4ug/mLSecondary (Goat Anti-Rabbit Cy3)Dilution: 1:1500)

product-image-AAA201723_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Mouse Gut TissuePrimaryDilution: 20ug/mL and 4ug/mLSecondary (Goat Anti-Rabbit Cy3)Dilution: 1:1500)
Related Product Information for anti-GRIA2 antibody
This is a rabbit polyclonal antibody against GRIA2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.
Product Categories/Family for anti-GRIA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
glutamate receptor 2 isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor AMPA type subunit 2
NCBI Official Symbol
GRIA2
NCBI Official Synonym Symbols
GLUR2; GLURB; GluA2; HBGR2; GluR-K2
NCBI Protein Information
glutamate receptor 2
UniProt Protein Name
Glutamate receptor 2
UniProt Gene Name
GRIA2
UniProt Synonym Gene Names
GLUR2; GluR-2; GluA2
UniProt Entry Name
GRIA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GRIA2 gria2 (Catalog #AAA201723) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIA2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRIA2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GRIA2 gria2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRGADQEYSA FRVGMVQFST SEFRLTPHID NLEVANSFAV TNAFCSQFSR. It is sometimes possible for the material contained within the vial of "GRIA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.